Protein Info for Ac3H11_4272 in Acidovorax sp. GW101-3H11

Annotation: Probable transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details TIGR04409: LPS export ABC transporter periplasmic protein LptC" amino acids 15 to 198 (184 residues), 171.4 bits, see alignment E=6.7e-55 PF06835: LptC" amino acids 19 to 199 (181 residues), 108.1 bits, see alignment E=2e-35

Best Hits

KEGG orthology group: K11719, lipopolysaccharide export system protein LptC (inferred from 75% identity to vei:Veis_0152)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165K1W6 at UniProt or InterPro

Protein Sequence (205 amino acids)

>Ac3H11_4272 Probable transmembrane protein (Acidovorax sp. GW101-3H11)
MIRVIRQGWDQLSIYLPVLLMGLLALGTWWLVRNAPMPQLPAIDRPVKHQPDYFMKNFSV
KSFDATGRLQSEVQGTEARHYPDTDTLEIDKVRMRSIGLDGRLTVATANRALSNADGSEV
QLFGNAIVTREPLPAKPGALAQPRMEFRGEFLHAFTNTERVRSDQPVTLTRGNDRFTADG
MDYDNLDQVLQLRGRVRGMILPGKK