Protein Info for Ac3H11_4271 in Acidovorax sp. GW101-3H11

Annotation: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (EC 3.1.3.45)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 TIGR01670: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family" amino acids 27 to 177 (151 residues), 149.6 bits, see alignment E=3.3e-48 PF08282: Hydrolase_3" amino acids 101 to 168 (68 residues), 27.5 bits, see alignment E=2.6e-10

Best Hits

Swiss-Prot: 42% identical to KDSC_YERPE: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (kdsC) from Yersinia pestis

KEGG orthology group: K03270, 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) [EC: 3.1.3.45] (inferred from 86% identity to vei:Veis_0153)

MetaCyc: 37% identical to 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase monomer (Escherichia coli BL21(DE3))
3-deoxy-manno-octulosonate-8-phosphatase. [EC: 3.1.3.45]

Predicted SEED Role

"3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (EC 3.1.3.45)" in subsystem KDO2-Lipid A biosynthesis (EC 3.1.3.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165K1W0 at UniProt or InterPro

Protein Sequence (189 amino acids)

>Ac3H11_4271 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (EC 3.1.3.45) (Acidovorax sp. GW101-3H11)
MAQSSQTSSSPALQIDPELLLRAQGVRVAFFDVDGVLTDGGLYFSETGETIKRFNTLDGH
GLKLLQKAGITPAVITGRDSAPLRVRLKALGVEHAVFGTEDKRPAAEQILATLGLTWAQA
AAMGDDWPDLPVMRRSAFACAPANAQTEVRHAAHFVTQARGGDGAARELCDLLLVATGRY
AALLADYTA