Protein Info for Ac3H11_4270 in Acidovorax sp. GW101-3H11

Annotation: Arabinose 5-phosphate isomerase (EC 5.3.1.13)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 305 to 325 (21 residues), see Phobius details PF01380: SIS" amino acids 51 to 181 (131 residues), 109.8 bits, see alignment E=8.8e-36 TIGR00393: sugar isomerase, KpsF/GutQ family" amino acids 54 to 323 (270 residues), 368.8 bits, see alignment E=9.1e-115 PF00571: CBS" amino acids 210 to 266 (57 residues), 32.9 bits, see alignment E=6.8e-12 amino acids 278 to 330 (53 residues), 35.3 bits, see alignment 1.2e-12

Best Hits

Swiss-Prot: 55% identical to KDSD_SALTI: Arabinose 5-phosphate isomerase KdsD (kdsD) from Salmonella typhi

KEGG orthology group: K06041, arabinose-5-phosphate isomerase [EC: 5.3.1.13] (inferred from 89% identity to vei:Veis_0154)

MetaCyc: 55% identical to D-arabinose 5-phosphate isomerase KdsD (Escherichia coli K-12 substr. MG1655)
Arabinose-5-phosphate isomerase. [EC: 5.3.1.13]

Predicted SEED Role

"Arabinose 5-phosphate isomerase (EC 5.3.1.13)" in subsystem KDO2-Lipid A biosynthesis (EC 5.3.1.13)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165K1V2 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Ac3H11_4270 Arabinose 5-phosphate isomerase (EC 5.3.1.13) (Acidovorax sp. GW101-3H11)
MTPAPAALPPFDADQALRLARETFDIEAAALTGLAARVDGVFAQAVQMVLQARGRVVVMG
MGKSGHVGRKIAATLASTGTPAFFVHPAEASHGDLGMVTGDDLVLAISNSGESGELTAIL
PVLRRLGAPLIAMTGGLQSTLARYADLVLDCSVEREACPLNLAPTASTTAQLAMGDALAV
ALLDARGFRPEDFARSHPGGALGRKLLTHVSDVMRSGTEVPRVAPEASFSDLMREMSAKG
LGASAIVDAAGQVLGIFTDGDLRRRIEAGADLRTATAAQVMHPHPRRIAPDALAVDAAEM
MEAHAITSVLVLDAAGVLVGVVHIGDLMRAKVI