Protein Info for Ac3H11_424 in Acidovorax sp. GW101-3H11

Annotation: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00243: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  • amino acids 3 to 386 (384 residues), 473.7 bits, E=2.1e-146
• PF02670: DXP_reductoisom
  • amino acids 6 to 134 (129 residues), 155.6 bits, E=1.7e-49
• PF08436: DXP_redisom_C
  • amino acids 148 to 234 (87 residues), 125.5 bits, E=1.1e-40
• PF13288: DXPR_C
  • amino acids 266 to 382 (117 residues), 117.4 bits, E=6.5e-38

Best Hits

Swiss-Prot: 59% identical to DXR_CUPMC: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K00099, 1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC: 1.1.1.267] (inferred from 87% identity to vei:Veis_1444)

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 1.1.1.267)

MetaCyc Pathways

• methylerythritol phosphate pathway II (8/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (10/12 steps found)
• taxadiene biosynthesis (engineered) (10/13 steps found)
• methylerythritol phosphate pathway I (7/9 steps found)
• isoprene biosynthesis I (7/10 steps found)
• superpathway of ergosterol biosynthesis II (11/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.267

Sequence Analysis Tools

See A0A165LK64 at UniProt or InterPro

Protein Sequence (393 amino acids)

>Ac3H11_424 1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267) (Acidovorax sp. GW101-3H11)
MMKQKITVLGSTGSIGTSTLDVVARHPDRFEVFALSAATQVDLLLAQCAQFRPRYAVMAS
APHAQLLAEKIKENSLPTRVLFEVNAIENIASHPDVDAVMAAIVGAAGLGPCLAAARAGK
RLLLANKEALVVGGGLFMQTVRQGGATLLPIDSEHSAIFQCLPEDPSTWPDRVDSILLTA
SGGPFRQRDPATLAEITPAQACAHPNFSMGRKISVDSATMMNKALEVIEARWLFDLHPDQ
IKVVIHPQQIIHSMVQFKDASILAQLGTPDMRVPIACGLAWPERIASGASKLDFSTLSAL
AFEEADAVRFPGLHLSWQALKAAEGTTAVLNAANEVAVGAFLSGRLRFDRIHAVNLATLE
AVTPSKPDSLEALLDLDTQARSAAEHAAGRLAA