Protein Info for Ac3H11_4238 in Acidovorax sp. GW101-3H11

Annotation: peptidase M48, Ste24p

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 PF01435: Peptidase_M48" amino acids 75 to 226 (152 residues), 97.9 bits, see alignment E=3.5e-32

Best Hits

Swiss-Prot: 44% identical to LOIP_ECOLI: Metalloprotease LoiP (loiP) from Escherichia coli (strain K12)

KEGG orthology group: K07387, putative metalloprotease [EC: 3.4.24.-] (inferred from 46% identity to bph:Bphy_2547)

MetaCyc: 44% identical to metalloprotease LoiP (Escherichia coli K-12 substr. MG1655)
3.4.24.-

Predicted SEED Role

"peptidase M48, Ste24p"

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165K185 at UniProt or InterPro

Protein Sequence (229 amino acids)

>Ac3H11_4238 peptidase M48, Ste24p (Acidovorax sp. GW101-3H11)
VWAQFNFGKALEAGQDLVKAESITDEELNKYFDQVTVQMDSQSSVAPGSNAYAKRLTKMV
TGLQTYDGMRLNFKVYVTPQINAFAMANGTIRVYSGLMDAFTDDEVRYVIGHEIGHVKSG
HSKSRMQAALRTSALRKGVESSNTRAGALASTELGNLFEKVVNAQHSQSNEREADDYALK
FMKAKKYNPQACVTALEKLASLSGDSSSSFLSTHPAPKDRASRLREQLA