Protein Info for Ac3H11_4175 in Acidovorax sp. GW101-3H11

Annotation: TRAP-type C4-dicarboxylate transport system, large permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 signal peptide" amino acids 5 to 5 (1 residues), see Phobius details transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 133 to 157 (25 residues), see Phobius details amino acids 169 to 194 (26 residues), see Phobius details amino acids 214 to 232 (19 residues), see Phobius details amino acids 238 to 254 (17 residues), see Phobius details amino acids 266 to 291 (26 residues), see Phobius details amino acids 312 to 344 (33 residues), see Phobius details amino acids 356 to 380 (25 residues), see Phobius details amino acids 392 to 417 (26 residues), see Phobius details PF06808: DctM" amino acids 6 to 414 (409 residues), 335.2 bits, see alignment E=2.8e-104 TIGR00786: TRAP transporter, DctM subunit" amino acids 14 to 418 (405 residues), 363.7 bits, see alignment E=5.3e-113

Best Hits

KEGG orthology group: None (inferred from 87% identity to ctt:CtCNB1_4595)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165M2R2 at UniProt or InterPro

Protein Sequence (421 amino acids)

>Ac3H11_4175 TRAP-type C4-dicarboxylate transport system, large permease component (Acidovorax sp. GW101-3H11)
MITTLFFLAALMVGVPIGVCLCLSGAVYILSIGSPVLFQSFPMQMFGGVDSYGLIAIPLF
ILIGEIMNSGGITRRLVDLSMAFIGSVKGGLAYVNILANMLVSSIIGSATAQVAIMSQVM
VPEMEKQGYDKTFAAGLTVYGGMLGPIIPPSVMFVVYSVLAQVAVGDMLIAGILPGVLLT
LLFFVVIALMGFVYNYPRSEKRTLAQRARTVVQASPTLLIPIIIVGSILSGLANPTESAA
VGALASALVGRYVTKEFRFSAMPAILLRSAIYSAIVLFLVAAAAVFSWLLIYGKVPQMVA
AWVQTVAHDPVTFLLLTNVILLVIGTVIDGIPGLIMTAPILLPIATEVYHIDPRHFGVVI
VVNLVLGLMTPPVGLSFFVASAVTGAKPGKMFIVTLPFFIISCVALVMLSLFPSLSLGLL
K