Protein Info for Ac3H11_4029 in Acidovorax sp. GW101-3H11

Annotation: Biotin carboxyl carrier protein of acetyl-CoA carboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00531: acetyl-CoA carboxylase, biotin carboxyl carrier protein
  • amino acids 1 to 150 (150 residues), 179.6 bits, E=2.9e-57
• PF00364: Biotin_lipoyl
  • amino acids 77 to 149 (73 residues), 84.4 bits, E=4.1e-28

Best Hits

Swiss-Prot: 57% identical to BCCP_ECOLI: Biotin carboxyl carrier protein of acetyl-CoA carboxylase (accB) from Escherichia coli (strain K12)

KEGG orthology group: K02160, acetyl-CoA carboxylase biotin carboxyl carrier protein (inferred from 90% identity to adn:Alide_3668)

MetaCyc: 57% identical to biotin carboxyl carrier protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Biotin carboxyl carrier protein of acetyl-CoA carboxylase" in subsystem Fatty Acid Biosynthesis FASII

MetaCyc Pathways

• biotin-carboxyl carrier protein assembly (4/4 steps found)
• 3-hydroxypropanoate cycle (8/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• superpathway of the 3-hydroxypropanoate cycle (8/18 steps found)
• glyoxylate assimilation (4/13 steps found)

Sequence Analysis Tools

See A0A165LZ70 at UniProt or InterPro

Protein Sequence (150 amino acids)

>Ac3H11_4029 Biotin carboxyl carrier protein of acetyl-CoA carboxylase (Acidovorax sp. GW101-3H11)
MDLRKLKTLIDLVSESNVSELEITEAEGKVRIVKSGGAVVQQYVPAPMQAPVAPAPAAAA
PVAELPAPPAVPAGHIVKSPMVGTFYRSSSPGAKAFVEVGSQVKEGETICIIEAMKILNE
IEADKSGTVTRIMGENGQAVEYGQPLFVIE