Protein Info for Ac3H11_4009 in Acidovorax sp. GW101-3H11

Annotation: Putative sensor-like histidine kinase YfhK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 163 to 183 (21 residues), see Phobius details PF00672: HAMP" amino acids 177 to 228 (52 residues), 27.6 bits, see alignment 4.5e-10 PF00512: HisKA" amino acids 234 to 295 (62 residues), 39.9 bits, see alignment E=5.2e-14 PF02518: HATPase_c" amino acids 346 to 456 (111 residues), 80.7 bits, see alignment E=1.7e-26

Best Hits

KEGG orthology group: K07711, two-component system, NtrC family, sensor histidine kinase YfhK [EC: 2.7.13.3] (inferred from 66% identity to aaa:Acav_0806)

Predicted SEED Role

"Putative sensor-like histidine kinase YfhK" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165LYU9 at UniProt or InterPro

Protein Sequence (459 amino acids)

>Ac3H11_4009 Putative sensor-like histidine kinase YfhK (Acidovorax sp. GW101-3H11)
LLIAGLLGASALRAVFTLEALMGQSQASAAQAAALNVAAQALNQRGQAMERSARQSLVLN
DPLLRQSFDDMAADAQGIVRQLSDAGLPPPQALQWQAHTQTVHDLLRAPPWQSLENERSV
AEEFVALDTLHAAITQSVQELNARQASELQARVDASRSTVMHQLVGAIVLALVLALWLGI
WLARPFTRLERAIRRLGENQLEQPVAITGPADVRRVGQQLEWLRLRLLELDADKARFLRH
VSHELKTPLAALREGVALLQDGVTGELSEGQQEVTQILHQNTLVLQSEIEALLRFNAAAF
EARQLQRRETDLVALLEDLVEAQRLQWQARSLRVEVSGERTVLLLDAEKITSAMGNLLSN
AIRFSPENGTVRLAVSRTSGQVQVDVTDEGPGVAPADRAHVFEPFYRGERQPENAVRGTG
IGLSIVQEYIHAHGGRVQVLQMPGDAPRSFFRIELPDVS