Protein Info for Ac3H11_39 in Acidovorax sp. GW101-3H11

Annotation: Inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF06167: Peptidase_M90" amino acids 9 to 270 (262 residues), 248.7 bits, see alignment E=3.2e-78

Best Hits

KEGG orthology group: K09933, hypothetical protein (inferred from 73% identity to adn:Alide_2113)

Predicted SEED Role

"Inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165HYT5 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Ac3H11_39 Inner membrane protein (Acidovorax sp. GW101-3H11)
MPPFLNRLWRHVRSTVAPVPDISATLWLQTLQRYPFLAALSLHDQSKLRALSALFLHYKE
FHGAHGLVVTDAMAIDIAAQACLPLLHWGDPAKALAWYDDFVGIVLHPGEAVARRKTMDD
AGVVHEHTQVLLGEAMERGPIMLSWEHVANAAENTARGHNVVVHEFVHKLDMKSGEPNGC
PPLPAGFMGARTGRAAYEAWWNAWEPAYRDFREAVIKAERFGAERPWLDAYGATSQSEFF
AVACEAYFVSRARFAQEFPGLMPVLDTFFQRPTHAN