Protein Info for Ac3H11_3899 in Acidovorax sp. GW101-3H11

Annotation: Chromosome partitioning protein ParA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 PF09140: MipZ" amino acids 3 to 51 (49 residues), 21.6 bits, see alignment E=2.4e-08 PF13614: AAA_31" amino acids 3 to 50 (48 residues), 35.1 bits, see alignment 2.7e-12 PF01656: CbiA" amino acids 4 to 180 (177 residues), 50.7 bits, see alignment E=3.5e-17

Best Hits

KEGG orthology group: K03496, chromosome partitioning protein (inferred from 79% identity to dia:Dtpsy_2866)

Predicted SEED Role

"Chromosome partitioning protein ParA" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165LW58 at UniProt or InterPro

Protein Sequence (205 amino acids)

>Ac3H11_3899 Chromosome partitioning protein ParA (Acidovorax sp. GW101-3H11)
MPVVVVANPKGGVGKSTLSTNIAGYFASQGHPVILGDTDRQESARLWLGLRPPAARAIGG
WDTSSDVISRPPKGTTHAVLDTPAGLHGWRLNDVLKLADKIIVPLQPSVFDIFATRSFLD
QLAEHRRADGVQIGIVGMRVDARTKAAEQLHHFVDSLGFPVLGYLRDTQNYVHLAAHGLT
LFDVSPGRVARDLEQWPGICAWLNS