Protein Info for Ac3H11_3873 in Acidovorax sp. GW101-3H11

Annotation: Ribosomal RNA small subunit methyltransferase D (EC 2.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 TIGR00095: 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD" amino acids 44 to 226 (183 residues), 140.2 bits, see alignment E=3.2e-45 PF03602: Cons_hypoth95" amino acids 49 to 223 (175 residues), 148.6 bits, see alignment E=1.7e-47 PF05175: MTS" amino acids 80 to 171 (92 residues), 24.7 bits, see alignment E=1.6e-09

Best Hits

KEGG orthology group: None (inferred from 74% identity to ajs:Ajs_3517)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase D (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165LVI4 at UniProt or InterPro

Protein Sequence (227 amino acids)

>Ac3H11_3873 Ribosomal RNA small subunit methyltransferase D (EC 2.1.1.-) (Acidovorax sp. GW101-3H11)
MSRSTLRGSAITAEIRKAQAAAAAPPVAPKKGAKDKPAAAAAPKGAGEIRIIGGQWKRTR
LPVAQRPGLRPTPDRVRETLFNWLGQDLNGWRCLDAFAGTGALGLEAASRGAASVQLVES
DAALVAQLQVLQAKLQASAVRVQRGDGVAALKQAAPASVDLVLLDPPFDGDLFAPALQAA
AKAVAAEGFIYLEAPRAWTDEELAPSGLVLYRHLKAGAVHAHLLKRG