Protein Info for Ac3H11_3817 in Acidovorax sp. GW101-3H11

Annotation: strictosidine synthase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF20067: SSL_N" amino acids 46 to 91 (46 residues), 70.9 bits, see alignment 1.3e-23 PF08450: SGL" amino acids 79 to 284 (206 residues), 58.2 bits, see alignment E=2e-19 PF03088: Str_synth" amino acids 154 to 242 (89 residues), 65.9 bits, see alignment E=6e-22 PF01731: Arylesterase" amino acids 191 to 245 (55 residues), 21.7 bits, see alignment 3.8e-08

Best Hits

KEGG orthology group: None (inferred from 72% identity to vpe:Varpa_4631)

Predicted SEED Role

"strictosidine synthase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165LU65 at UniProt or InterPro

Protein Sequence (372 amino acids)

>Ac3H11_3817 strictosidine synthase family protein (Acidovorax sp. GW101-3H11)
MAGTWVKRAGWGVGGAVVAVAAYLAAWPVPIQPVAWTAPAAPGYQGVHAPNQRLAQLNII
DLKGEVGPEHIAFGKDGKLYTTVLSGNILRMNPDGSGQEVFANTGGRVLGFDFDAAGNLI
AADAVKGLLSIASDGKVTVLADKVGGDPIRYADAVVVAQSGKMYLSDASTRFAPKDWGGT
FEASVLDILEQASTGRVIEYDPATRSTRVVARGISFANGVALSQDEKHLFVNETGKYRVW
KIAVDANDLDIAQPSPQARVLLDNLPGYPDNLMRGQGGKVWLGFAKPRGAAIDNMAGKPW
LRSLTLRLPRALWPIPQPYGHVIAFTDDGKVVADLQDPSGAYPETTAITETADRLYVQSL
HAHGLGWLPNKP