Protein Info for Ac3H11_3739 in Acidovorax sp. GW101-3H11

Annotation: D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF02826: 2-Hacid_dh_C" amino acids 3 to 77 (75 residues), 29.8 bits, see alignment E=9.5e-11 PF03807: F420_oxidored" amino acids 5 to 65 (61 residues), 24 bits, see alignment E=1.3e-08 PF03446: NAD_binding_2" amino acids 5 to 165 (161 residues), 126.6 bits, see alignment E=2.4e-40 PF02737: 3HCDH_N" amino acids 5 to 43 (39 residues), 23.7 bits, see alignment 1e-08 PF14833: NAD_binding_11" amino acids 171 to 290 (120 residues), 122.1 bits, see alignment E=4e-39

Best Hits

Swiss-Prot: 66% identical to LTND_CUPNH: L-threonate dehydrogenase (ltnD) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00020, 3-hydroxyisobutyrate dehydrogenase [EC: 1.1.1.31] (inferred from 83% identity to rpi:Rpic_3732)

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.30, 1.1.1.31

Use Curated BLAST to search for 1.1.1.30 or 1.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165IQK4 at UniProt or InterPro

Protein Sequence (303 amino acids)

>Ac3H11_3739 D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30) (Acidovorax sp. GW101-3H11)
MTKPTVGIIGLGAMGAGIAKTLRNNGFTIHVCDVRPGVADAFVADGGTAHATTAALAAVS
DVVVSVVVNAAQTESVLFGDDGQSGAVSTMRPGSTFVMCSTVDPNWSVALEARLNALGLH
YVDAPISGGAAKAASGQMTMMTSAKPEAYAAANAVLDGMAGKVYRLGDKAGAGSKVKIIN
QLLAGVHIAVAAEAMALGLREGVEASALYEVITNSAGNSWMFENRMAHVLAGDYTPLSAV
DIFVKDLGLVLDTARASKFPLPLAATAHQMFMQASTAGFAKEDDSAVIKIFPGITLPEGK
DKA