Protein Info for Ac3H11_3738 in Acidovorax sp. GW101-3H11

Annotation: FIG00641944: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 PF07005: SBD_N" amino acids 8 to 231 (224 residues), 263 bits, see alignment E=2.7e-82 PF17042: NBD_C" amino acids 256 to 416 (161 residues), 156.8 bits, see alignment E=7.5e-50

Best Hits

Swiss-Prot: 58% identical to OTNK_PSEF5: 3-oxo-tetronate kinase (otnK) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: None (inferred from 81% identity to vei:Veis_2460)

MetaCyc: 60% identical to 3-dehydrotetronate 4-kinase monomer (Cupriavidus necator H16)
RXN-18594 [EC: 2.7.1.217]; 2.7.1.217 [EC: 2.7.1.217]

Predicted SEED Role

"FIG00641944: hypothetical protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.217

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165IQJ7 at UniProt or InterPro

Protein Sequence (425 amino acids)

>Ac3H11_3738 FIG00641944: hypothetical protein (Acidovorax sp. GW101-3H11)
MTRARALLGCIADDFTGATDLANNLVRAGMRVVQAMGVPTAPLDAEADAIVVALKSRTIA
KDEAIAQSLAALQWLQAQGAEQIYFKYCSTFDSTAEGNIGPVTDALMQALGTDFTIATPA
FPDNKRTVFKGYLFVGDVLLNESGMQNHPLTPMTDPNLVRVLQAQTPSRVGLIDHSVVAQ
GEAAIRARIDQLKAEGMRMAVVDAVSNADLLRLGPALKGMPLVTAGSGVAIGLPGNFGVA
PSNEAARLPAAQGLQAIVSGSCSVATNQQVMDFIKAGQPALAIDPLRIAAGVDVAAEALA
WAENHIGQGPVLVYSTAEPSAVRAIQGKLGSEKAGAMVEDTIAAIARGLVQRGVRQLIVA
GGETSGACVQALGITQMRIGAQIDPGVPWCHAVAPDTKDGLHITLKSGNFGSTDFFTKAF
AQLSA