Protein Info for Ac3H11_3737 in Acidovorax sp. GW101-3H11

Annotation: Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 PF00596: Aldolase_II" amino acids 16 to 210 (195 residues), 143.9 bits, see alignment E=2.7e-46

Best Hits

Swiss-Prot: 52% identical to OTNC_CUPNH: 3-oxo-tetronate 4-phosphate decarboxylase (otnC) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: None (inferred from 73% identity to xtr:100489656)

Predicted SEED Role

"Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165IQV6 at UniProt or InterPro

Protein Sequence (236 amino acids)

>Ac3H11_3737 Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases (Acidovorax sp. GW101-3H11)
MTSTPAFMDEPQARDEICRVGRSLFERGYVHATAGNISVRLADGYLITPTDACLGTLQPE
RLARLDAQGQQVAGDRASKTITLHRQIYEASASTAAPARCVIHTHSTHLVACSLQADMTT
NGPLGPDTQLLPPITPYFVMKVGRVPHIPYHRPGDPAAAALVAQTIGRYAAKGSPVRAVM
LARLGPNVWHDTPAAAMAVLEELEETARLWMLCQPRPTPLTEPQIEELRQSFGAHW