Protein Info for Ac3H11_3733 in Acidovorax sp. GW101-3H11

Annotation: cytidine/deoxycytidylate deaminase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 PF00383: dCMP_cyt_deam_1" amino acids 38 to 136 (99 residues), 74.4 bits, see alignment E=5.8e-25 PF14437: MafB19-deam" amino acids 41 to 139 (99 residues), 58.6 bits, see alignment E=6.3e-20

Best Hits

KEGG orthology group: None (inferred from 72% identity to vpe:Varpa_4599)

Predicted SEED Role

"cytidine/deoxycytidylate deaminase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165IQU9 at UniProt or InterPro

Protein Sequence (191 amino acids)

>Ac3H11_3733 cytidine/deoxycytidylate deaminase family protein (Acidovorax sp. GW101-3H11)
LHNDCHPPTIDGDTYTMHALMSAPPASFDDPTPINDTDGTYLRQAIAWSCTARARGNRPF
GAVVISAEGRLLAEAYCNTTETGDCTGHAETNAVRQLSPRVGRDALAQATLYSSAEPCVM
CAGAIFWSGIGRVVFGIDAERLRVFRGERAEQRDAELSCRDVFAASPHAIECIGPALVDE
ASAPHVGFWKT