Protein Info for Ac3H11_3688 in Acidovorax sp. GW101-3H11

Annotation: Histone acetyltransferase HPA2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF00583: Acetyltransf_1" amino acids 22 to 135 (114 residues), 53.1 bits, see alignment E=3.7e-18 PF13508: Acetyltransf_7" amino acids 64 to 142 (79 residues), 35.2 bits, see alignment E=1.3e-12

Best Hits

Swiss-Prot: 53% identical to YSNE_BACSU: Uncharacterized N-acetyltransferase YsnE (ysnE) from Bacillus subtilis (strain 168)

KEGG orthology group: K03829, putative acetyltransferase [EC: 2.3.1.-] (inferred from 67% identity to aaa:Acav_3425)

Predicted SEED Role

"Histone acetyltransferase HPA2"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165IPG6 at UniProt or InterPro

Protein Sequence (162 amino acids)

>Ac3H11_3688 Histone acetyltransferase HPA2 (Acidovorax sp. GW101-3H11)
MAALPAPLQIRLDDLSDPRIEAFMQEHLQDMYAVSPPESVHALDMDQLRQPGIAFWSAWL
PGADGGMLVGTGALKRLDADHAELKSMRTSARHRGQGIARQVLAHLLQEARARGFTRVSL
ETGPQPFFEPARQLYFQHDFVECGPFADYGLDPYSFFMTRPV