Protein Info for Ac3H11_3687 in Acidovorax sp. GW101-3H11

Annotation: Urease accessory protein UreE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 PF02814: UreE_N" amino acids 14 to 71 (58 residues), 72.7 bits, see alignment E=1.4e-24 PF05194: UreE_C" amino acids 78 to 171 (94 residues), 81.9 bits, see alignment E=3.4e-27

Best Hits

Swiss-Prot: 82% identical to UREE_ACIAC: Urease accessory protein UreE (ureE) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K03187, urease accessory protein (inferred from 82% identity to aaa:Acav_3426)

Predicted SEED Role

"Urease accessory protein UreE" in subsystem Urea decomposition

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165IPF6 at UniProt or InterPro

Protein Sequence (216 amino acids)

>Ac3H11_3687 Urease accessory protein UreE (Acidovorax sp. GW101-3H11)
MLQASKLLPQGQGLAPVLLKRATTVELDWDVRQKSRFAATDSAGRELGIFLPRGTLVRGG
DVLVAEDGSMVRVIAAPQPVLVITHCTQHGTPFDLTRAAYHLGNRHVPIELQPDHLKIEP
DHVLADMLRAMHLIVTAQNLAFEPEGGAYAAGHGGGHHHHGGHDHGHDHGHGHEHDHSHA
QTPAVAAASAPARGRTVAIPVVAQGHVHGPHCNHDH