Protein Info for Ac3H11_3524 in Acidovorax sp. GW101-3H11

Annotation: TRAP-type C4-dicarboxylate transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 35 to 287 (253 residues), 262.4 bits, see alignment E=2.1e-82 PF03480: DctP" amino acids 35 to 312 (278 residues), 301 bits, see alignment E=4.3e-94

Best Hits

Swiss-Prot: 37% identical to YIAO_ECOLI: 2,3-diketo-L-gulonate-binding periplasmic protein YiaO (yiaO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 84% identity to lch:Lcho_2458)

MetaCyc: 37% identical to 2,3-diketo-L-gulonate:Na+ symporter - periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-235

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165J0S3 at UniProt or InterPro

Protein Sequence (335 amino acids)

>Ac3H11_3524 TRAP-type C4-dicarboxylate transport system, periplasmic component (Acidovorax sp. GW101-3H11)
MQFKTLALAATLLAALAAPVAAQVKEHTFKVGIGLSDDHPQAQAVRHFAERLQAKSGGKM
NAKLFASGALGNDVSMTSALRGGTLEMTIPDSSTLMSLIKPFGVLNLPLTFNTEAEADAL
LDGPFGQKLLAMLPDKGLIGLGFWENGFRHVTNSRRAINTADDLAGLKLRVIQSPLFLDT
FSALGTNATPMPFTELYTAMEQKAVDGQENPPATILASKFYEVQKHLVLSRHMYSAWVLL
ISKKTWDGLSADERKIVQEAAREATLFERKTIRAFSQTALGELKKAGMQITELPAAEQAK
LRTKLQPVLAKYGKEFGEETTSEMMGELAKARGGK