Protein Info for Ac3H11_3521 in Acidovorax sp. GW101-3H11

Annotation: TRAP-type transport system, small permease component, predicted N-acetylneuraminate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 49 to 66 (18 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details PF04290: DctQ" amino acids 24 to 152 (129 residues), 91.1 bits, see alignment E=2.8e-30

Best Hits

KEGG orthology group: None (inferred from 66% identity to vap:Vapar_3328)

Predicted SEED Role

"TRAP-type transport system, small permease component, predicted N-acetylneuraminate transporter" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165J0P1 at UniProt or InterPro

Protein Sequence (189 amino acids)

>Ac3H11_3521 TRAP-type transport system, small permease component, predicted N-acetylneuraminate transporter (Acidovorax sp. GW101-3H11)
MLNAFIDRCCRAINLLIALALAVMVVMVFGNVVLRYAFNSGIAISEEVSRWLFVWITFLG
AIVAVRERGHLGTDFLLARLPPLGQRICLAISYALMIWCTWLLFSGALAQARINWDVDAP
VTGASMAIFYASGVVFAVAAGLLLALDLWRIVSGQMPDSELLHIAESEELAAVGSQLPHA
APAPTASRQ