Protein Info for Ac3H11_3518 in Acidovorax sp. GW101-3H11

Annotation: Rrf2-linked NADH-flavin reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF03435: Sacchrp_dh_NADP" amino acids 3 to 69 (67 residues), 26.4 bits, see alignment E=2.3e-09 PF05368: NmrA" amino acids 3 to 103 (101 residues), 40.7 bits, see alignment E=5.6e-14 PF03807: F420_oxidored" amino acids 3 to 57 (55 residues), 22.3 bits, see alignment E=4.8e-08 PF01370: Epimerase" amino acids 4 to 106 (103 residues), 40.7 bits, see alignment E=5.8e-14 PF01073: 3Beta_HSD" amino acids 5 to 107 (103 residues), 26.7 bits, see alignment E=8.7e-10 PF13460: NAD_binding_10" amino acids 7 to 200 (194 residues), 131.1 bits, see alignment E=1.4e-41

Best Hits

KEGG orthology group: K07118, (no description) (inferred from 69% identity to pol:Bpro_4581)

Predicted SEED Role

"Rrf2-linked NADH-flavin reductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165J0L8 at UniProt or InterPro

Protein Sequence (213 amino acids)

>Ac3H11_3518 Rrf2-linked NADH-flavin reductase (Acidovorax sp. GW101-3H11)
MNIALIGATGFVGSAVLNELLQRGHRVTVLARNPGKLTPREGLTVVAADAQDAAQVAKAA
AGHDAVVSAYNPGWTVPDIHDQFLKGTRATIDGTKQAGVRRFLMVGGAGSLFVAPGLQLV
DTPQFPAEWKQGALAAREALNWIRTENTLDWTFLSPPILLQPGERTGQYRLGDEAPLMNG
EQPGSISVADLAVAIVDELEAPRHVQKRFTVAN