Protein Info for Ac3H11_3484 in Acidovorax sp. GW101-3H11

Annotation: Cell division protein FtsK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 524 PF05272: VapE-like_dom" amino acids 184 to 352 (169 residues), 26.9 bits, see alignment E=3.3e-10 PF19263: DUF5906" amino acids 211 to 319 (109 residues), 70 bits, see alignment E=2.7e-23

Best Hits

Predicted SEED Role

"Cell division protein FtsK" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton or Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165IZS4 at UniProt or InterPro

Protein Sequence (524 amino acids)

>Ac3H11_3484 Cell division protein FtsK (Acidovorax sp. GW101-3H11)
VDFGAGKGQGGGAASSDAESGPSSAPPPLPQSSAAARMSGDGGGDAGEPSEPPADDAAGD
KPVQGRKKEKTIDWGKFNHLVEHFVLIYGTDTVWDGSERLQMKIANMGHAHGADMVRMWK
SSERRRTVRLDDVVFDPTMQCDPETTVNLYDGMAMVPKEGNVDPILDLVRYLTSRAAEHD
AECDEIMHWLLCWLAYPLQHPGAKLRTAVVMHGDEGAGKNFLFDIMVAIYGKYGALVGQD
ELEDKFNDWRSCKMFVVGDEVSSRAELVHNKNRLKALITSPTVQINPKNLARREEKNQMN
IVFLSNELQPLALDNSDRRYLVVYTPRAKDPDYYRKLGQWRDNGGAEAFYHFLLTYPLDG
FHPYSPAPMTAAKEALIEINRKSPEQFWAEWSGGELDLPYQACAVDQAYSAYLKWCQRTG
DRYPFKRNQFTPTLTRFAEGQSKPARIKAMNVARPGEAKKTTRMLLVCEPVLRAPDAGPD
DLLMTETEWATGSVVSFDKALKKYIGYGSGSPSHDGSEPDGGDA