Protein Info for Ac3H11_3419 in Acidovorax sp. GW101-3H11

Annotation: Transcriptional regulator PobR, AraC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF02311: AraC_binding" amino acids 37 to 135 (99 residues), 23.7 bits, see alignment E=7.2e-09 PF12833: HTH_18" amino acids 204 to 283 (80 residues), 71.7 bits, see alignment E=1.1e-23

Best Hits

KEGG orthology group: None (inferred from 57% identity to bja:bll2336)

Predicted SEED Role

"Transcriptional regulator PobR, AraC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KHC1 at UniProt or InterPro

Protein Sequence (293 amino acids)

>Ac3H11_3419 Transcriptional regulator PobR, AraC family (Acidovorax sp. GW101-3H11)
MHFSNIDGIRSYSLFGESQHLPDVLHCETIAERSVLHDWELAPHRHTRLHQVLLITSGGG
MAHLDGERVPLFAGALINVPQGHVHAFRFTQHTQGWVATLADELMDEIFVRVGDVRRDLA
RPAVAPAPPQLHQAMGQVWQEFSGRAKARALVLRGLSATLLGWVARAMEEHSPGDAAAPE
SSLVQRLEALIEAHFLEHWQVADYARALAVSPTHLSRVARAATGVSAQRLIEARLMREAR
RNLAYTHLGVATIAYTLGYADPAYFTRAFTRDAGLSPRAFRAQVAASAPAPAM