Protein Info for Ac3H11_3407 in Acidovorax sp. GW101-3H11

Annotation: 3-ketoacyl-CoA thiolase (EC 2.3.1.16)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 PF00108: Thiolase_N" amino acids 16 to 282 (267 residues), 169.5 bits, see alignment E=9.5e-54 TIGR01930: acetyl-CoA C-acyltransferase" amino acids 17 to 412 (396 residues), 375.5 bits, see alignment E=1.4e-116 PF02803: Thiolase_C" amino acids 291 to 412 (122 residues), 149.8 bits, see alignment E=2.8e-48

Best Hits

KEGG orthology group: K00626, acetyl-CoA C-acetyltransferase [EC: 2.3.1.9] (inferred from 72% identity to pol:Bpro_3113)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.9

Use Curated BLAST to search for 2.3.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KH18 at UniProt or InterPro

Protein Sequence (416 amino acids)

>Ac3H11_3407 3-ketoacyl-CoA thiolase (EC 2.3.1.16) (Acidovorax sp. GW101-3H11)
MTTEKNSFSAPLNAWLVDGVRTPMVDYCGPLGHVSPTDMGIKVARAVLARSGVPAADVGS
VITGSMAQADFDAFVLPRHIGLYAGVPLDVPSILVQRICGTGFELFRQAADQIALGYTDV
ALVVGTESMTRNPIAAYTHRTGFKLGAPVEFKDFLMEALIDTAGPVTMIETAENLAKKYG
ITREDVDAYASQSFARALKAQEDGFLAGEIVPVVSEKFELEGYATRGITLPRKVAQLDRD
THPRPSPVEALAALRTVYPGGVQTAGNSSALVDGAVGAVVASDAYVQQRGLKPLARLRGV
AAVGVAPEYMGIGPAPAIRALLARTGLTLDDIGLFEINEAQGAQTLAVGRELGLDLNKLN
VNGGAIALGHPLAATGVRLTVTLARELRRRGLRYGISSACVGGGQGIALLIENTDA