Protein Info for Ac3H11_3404 in Acidovorax sp. GW101-3H11

Annotation: MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR00368: Mg chelatase-like protein" amino acids 6 to 507 (502 residues), 576.4 bits, see alignment E=2.4e-177 PF13541: ChlI" amino acids 21 to 142 (122 residues), 137.3 bits, see alignment E=7.2e-44 PF01078: Mg_chelatase" amino acids 204 to 408 (205 residues), 315.7 bits, see alignment E=3.5e-98 PF07728: AAA_5" amino acids 228 to 362 (135 residues), 44.2 bits, see alignment E=6e-15 PF00493: MCM" amino acids 301 to 398 (98 residues), 31.6 bits, see alignment E=2.8e-11 PF13335: Mg_chelatase_C" amino acids 415 to 507 (93 residues), 96.7 bits, see alignment E=3.1e-31

Best Hits

KEGG orthology group: K07391, magnesium chelatase family protein (inferred from 86% identity to vei:Veis_3316)

Predicted SEED Role

"MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KGZ0 at UniProt or InterPro

Protein Sequence (514 amino acids)

>Ac3H11_3404 MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein (Acidovorax sp. GW101-3H11)
MSLALVQSRALLGMLAPSVTVEVHLANGLPSFTLVGLAEVEVKEARERVRSALQNAGLEF
PTNKRITVNLAPADLPKDSGRFDLPIALGILAASGQVDASRLAGYEFAGELSLSGELRPV
RGALATSLALQTQQIDTQLVLPPGSAEEAALVPAAQVVRARHLLDVVRAFLPPGSVAGGD
ADVANDGWTRLAATPMATCTTGPDMADVKGQAGAKRALEIAAAGGHSLLMAGPPGSGKSM
LAQRFAGLLPAMTVEEALESAAIASLTGRFRPEAWGQRPTGQPHHTASAVALVGGGSPPR
PGEISLAHQGVLFLDELPEFPRAALEALREPLETGHITIARAAQRAEFPARFQMIAAMNP
CPCGFLGSTQRACRCTPDQVNRYQAKLSGPLLDRIDLHVEVPALPAEQLVQAPAGESTTA
IRTRVEQARQRALARQGKSNQALQGQEIDAHLQLQDAAAKFLNTAAARLGWSARSTHRAL
KVARTIADLAGAADTEVGHVAEAVQYRRVLRHPA