Protein Info for Ac3H11_3329 in Acidovorax sp. GW101-3H11

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 84 to 101 (18 residues), see Phobius details amino acids 113 to 130 (18 residues), see Phobius details amino acids 137 to 154 (18 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details PF00892: EamA" amino acids 28 to 154 (127 residues), 52.1 bits, see alignment E=4e-18 amino acids 162 to 305 (144 residues), 63.7 bits, see alignment E=1e-21

Best Hits

KEGG orthology group: None (inferred from 85% identity to vei:Veis_1606)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KFA7 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Ac3H11_3329 Permease of the drug/metabolite transporter (DMT) superfamily (Acidovorax sp. GW101-3H11)
LKQAGRATGQPFLFIALPLCLSMKPERFGLMALLAVTVVWGTTFPAMKLLSTQLDALQII
WLRFVIALAVLAPLWWGMWRHERLWGCALGALLFLAFWLQIEGLARTSSNRNAFVTGLNV
LVVPLIAMAAMGRRYGWRLWAACGMALLGMTLMFHENEPWNLGDTLTLASTVFYALYILA
LEECARRTAARPLRATRMAAAQATVMAVASTLLLLGRDGGMGWLQATAHLPTDAWVALLY
LGLLASVVVVTLQAWGQQRVDAMRSAIVFGLEPVFAALTAWALLGERLGWAGLAGAALIV
AALVFSQIPPSARAQPA