Protein Info for Ac3H11_3326 in Acidovorax sp. GW101-3H11

Annotation: Amino acid ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 92 to 115 (24 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 225 to 245 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 50 to 148 (99 residues), 99.2 bits, see alignment E=7.9e-33 PF00528: BPD_transp_1" amino acids 70 to 252 (183 residues), 70.9 bits, see alignment E=6.1e-24

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 90% identity to aav:Aave_0300)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KF79 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Ac3H11_3326 Amino acid ABC transporter, permease protein (Acidovorax sp. GW101-3H11)
MLTAFWPQRWSRQQRSNATLVSAVILMVLALALLGQLLSFLPEPIGSNAQAFSDGARTTL
WLTLISGSVGLVLGTGAALARTARWAVVRWAASFYIWVIRGTPLLVQILFVYFALPVLVP
GLNLPDFAAAVLALGLNVGAYNAEAIRAGLLAVPRGQTEAAKALGLGRMHVFFDVVFPQA
FKISLPPLVSNFVALLKDSSLAYAIGVVELTNVGNRIQSATFQPIATLSTVAITYLLLTT
LVTQISNAVEYRFDVEGRNK