Protein Info for Ac3H11_3281 in Acidovorax sp. GW101-3H11

Annotation: UDP-galactose-lipid carrier transferase (EC 2.-.-.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 TIGR03709: polyphosphate:nucleotide phosphotransferase, PPK2 family" amino acids 21 to 275 (255 residues), 329.3 bits, see alignment E=7.8e-103 PF03976: PPK2" amino acids 42 to 260 (219 residues), 237.9 bits, see alignment E=5.4e-75

Best Hits

Swiss-Prot: 48% identical to PK23_MEIRD: Polyphosphate:AMP/ADP phosphotransferase (K649_10090) from Meiothermus ruber (strain ATCC 35948 / DSM 1279 / VKM B-1258 / 21)

KEGG orthology group: None (inferred from 82% identity to aaa:Acav_0226)

Predicted SEED Role

"UDP-galactose-lipid carrier transferase (EC 2.-.-.-)" (EC 2.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165HGS4 at UniProt or InterPro

Protein Sequence (281 amino acids)

>Ac3H11_3281 UDP-galactose-lipid carrier transferase (EC 2.-.-.-) (Acidovorax sp. GW101-3H11)
VPSPFAAAPSSLLQRLQPWQPPGKQMSLDDIDAGAKPFSLGDKARDKAAVEELAVELDAL
QNLFYADKRYKLLVVLQGTDTSGKDGTIRGVFARMSALGVHAVGWKAPTETERAHDYLWR
IHQQVPQAGDITVFNRSHYEDVLVPVVNGWITPDQHQQRLAHINDFERMLSETGTIVLKF
LLHIGKDEQRERLQERLDDPAKHWKFSMGDIDARKQWADYRRAYNTLLAATHTPWAPWTI
VPADSKTHRNLMVATVLRAVLQNLDLRYPTGDPALAHVTVA