Protein Info for Ac3H11_324 in Acidovorax sp. GW101-3H11

Annotation: AttF component of AttEFGH ABC transport system / AttG component of AttEFGH ABC transport system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 888 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 22 to 43 (22 residues), see Phobius details amino acids 278 to 302 (25 residues), see Phobius details amino acids 322 to 352 (31 residues), see Phobius details amino acids 375 to 395 (21 residues), see Phobius details amino acids 422 to 441 (20 residues), see Phobius details amino acids 447 to 468 (22 residues), see Phobius details amino acids 498 to 521 (24 residues), see Phobius details amino acids 759 to 782 (24 residues), see Phobius details amino acids 804 to 833 (30 residues), see Phobius details amino acids 852 to 872 (21 residues), see Phobius details PF02687: FtsX" amino acids 280 to 400 (121 residues), 51 bits, see alignment E=7e-18 amino acids 763 to 876 (114 residues), 54.8 bits, see alignment E=4.6e-19

Best Hits

Predicted SEED Role

"AttF component of AttEFGH ABC transport system / AttG component of AttEFGH ABC transport system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JNK1 at UniProt or InterPro

Protein Sequence (888 amino acids)

>Ac3H11_324 AttF component of AttEFGH ABC transport system / AttG component of AttEFGH ABC transport system (Acidovorax sp. GW101-3H11)
MQPMLALLRTFSWQDLRHHPWRSAAAVAAVMLGVALAFAVHVINASALDEFSQAVRAVNG
QPDLELRAMQGPLPEALYERLATDPQVARASPLLELSAVAQAVDATATPNPARTPLRVLG
ADALLLPPMAPALMPRPWDGADRFALFAPATVFLNTAALQALGLPTSGPQGDKDRGSPPP
TVLLITGLQQRVPVQVAGTVAAGGAPLAVMDIGAAQDLFGRQGALTRIDLQLQPGTDTAA
WQRTLHAEPGWPVNAVFAQPGDATQRISNLSRAYRVNLTVLALVALFTGAFLVFSVLALS
VAQRGPQFALLAVLGATPRQRLLLVLAESAALGLLGSVLGITLGTALAATALQLLGGDLG
GGYFAGVRPALQWSAPAALVYGALGVAAALVGGWWPARAAQQLPPAQTLKGLGTAASQAD
RGTLGLVLLAGGALLALAPPVGGVPLAAYVAIGLLLVGGIALLPWGMARLLAALQPLAAR
HTLPLLALERARRMRGSAAIAVGGVVASLSLAVALTVMVASFRGSVTQWLDAVLPSPLYV
RSALSTSSTTGTEAALLPAGFAEAVAQLPGVERVQALRASPVQLSPTLPALAVLSRPLGD
NPAQSLPMVGEPLSVPAGRTGVYISEAVVDLYGVRPGMEWPALSESFKPFACDGHAQAAI
FYIAGVWRDYARQSGAVALDRAAWLRLTGDARTSDLALWPREGTDTATLQTAIRTLAATH
AGRTASAGDHSEALVEFASSGAIRDRSLRIFDRSFAVTYWLQAVAIAIGLFGVAASFSAQ
VLARRKEFGLLAHLGLTRRQILTVVAGEGAAWTAVGAAAGMLLGLAVSVVLVHVVNPQSF
HWTMDLAVPGGRLLGLCAAVVVSGTVTAWLAGRAAAGRDAVMAVKEDW