Protein Info for Ac3H11_3228 in Acidovorax sp. GW101-3H11

Updated annotation (from data): gluconate TRAP transporter, small permease component
Rationale: Specifically important for gluconate utilization
Original annotation: Tripartite ATP-independent periplasmic transporter, DctQ component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 91 to 115 (25 residues), see Phobius details amino acids 130 to 153 (24 residues), see Phobius details PF04290: DctQ" amino acids 29 to 156 (128 residues), 68 bits, see alignment E=4.1e-23

Best Hits

KEGG orthology group: None (inferred from 75% identity to pna:Pnap_0045)

Predicted SEED Role

"Tripartite ATP-independent periplasmic transporter, DctQ component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165IVI0 at UniProt or InterPro

Protein Sequence (170 amino acids)

>Ac3H11_3228 gluconate TRAP transporter, small permease component (Acidovorax sp. GW101-3H11)
MSSPAQDAVPQSRFARVSQVLMASCLGVMAVAVFINVVLRYGFGSGVAASEELSRLLFVW
MVFIGAAAAYPAGEHMAFTSLAGLLAKRPVAFAALTAVIRLLVMAACAMLAWGAWQQVVV
GMGSRSVVMAYPAALLPLPAFLCAVAIGVMATIELIQRKPLDLGHGAEVE