Protein Info for Ac3H11_3213 in Acidovorax sp. GW101-3H11

Annotation: Branched-chain amino acid transport ATP-binding protein LivF (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 PF13476: AAA_23" amino acids 16 to 52 (37 residues), 36.8 bits, see alignment 1.6e-12 PF00005: ABC_tran" amino acids 22 to 163 (142 residues), 105.8 bits, see alignment E=7.6e-34 PF13514: AAA_27" amino acids 23 to 54 (32 residues), 22.5 bits, see alignment 1.9e-08 PF13304: AAA_21" amino acids 32 to 54 (23 residues), 29.7 bits, see alignment (E = 1.6e-10)

Best Hits

Swiss-Prot: 47% identical to LIVF_SALTI: High-affinity branched-chain amino acid transport ATP-binding protein LivF (livF) from Salmonella typhi

KEGG orthology group: K01996, branched-chain amino acid transport system ATP-binding protein (inferred from 54% identity to tmr:Tmar_0523)

MetaCyc: 46% identical to branched chain amino acid/phenylalanine ABC transporter ATP binding subunit LivF (Escherichia coli K-12 substr. MG1655)
ABC-15-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivF (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165IV65 at UniProt or InterPro

Protein Sequence (236 amino acids)

>Ac3H11_3213 Branched-chain amino acid transport ATP-binding protein LivF (TC 3.A.1.4.1) (Acidovorax sp. GW101-3H11)
MSGAHLTVQNLTTGYHGFQVLQDLSLQAAPGITVIVGPNGAGKTTLLKALAGLLPRTGTV
ALDGSDLPAMNATACVQRGLALVAEGRQLFPQMTVTENLELGGWLVPSRTRADRLAQAFE
DFPRLKERATQLAGTMSGGEQQMVAVARALMSGPRLLMLDEPSLGLAPRMVDELLAIVQR
IAAQGVTVLMVEQNVRKALQIAQRGYVLERGRIVASGAASDLLQSDVVRQAYLGVA