Protein Info for Ac3H11_3196 in Acidovorax sp. GW101-3H11

Annotation: FIG001454: Transglutaminase-like enzymes, putative cysteine proteases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 682 transmembrane" amino acids 17 to 49 (33 residues), see Phobius details amino acids 61 to 79 (19 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 111 to 128 (18 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 573 to 594 (22 residues), see Phobius details PF11992: TgpA_N" amino acids 20 to 344 (325 residues), 236.6 bits, see alignment E=4e-74 PF01841: Transglut_core" amino acids 399 to 495 (97 residues), 78.5 bits, see alignment E=4.6e-26

Best Hits

KEGG orthology group: None (inferred from 72% identity to vei:Veis_2098)

Predicted SEED Role

"FIG001454: Transglutaminase-like enzymes, putative cysteine proteases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165IUT5 at UniProt or InterPro

Protein Sequence (682 amino acids)

>Ac3H11_3196 FIG001454: Transglutaminase-like enzymes, putative cysteine proteases (Acidovorax sp. GW101-3H11)
MTLRQTLHALPRDARDTLFLLCVIAWVIAPQVNVLPVWACLLAGGLLLWRGWLAWKGRPL
PTRWVLAIPLILAVGGTLYTHRTILGRDAGVTLIVMLLALKMLELRARRDAMVVFFLGFF
TMLSNFFFSQSLFTAAAMLVALLGLLAAVVNAHMPVGRPPLTQTLRTAGTMALLGAPIMA
ALFMLFPRMAPLWGMPSDTMAGRSGLSGVMKVGNIAELALDDSVAMRVRFDTPNGAPPPQ
SDLYFRGPVFGAFDGVEWHPLGARSGDMLQSSPSTLANLQVRGEPVRYEVTLEAHQRPWL
LLLDAAATKPAISGMDTLMTQDLQWLTNRPITAVVRYKAESHPDFSHGPSAPTPSLRAYT
ELPASFNPRTLALAQQMRNDPQIAPNPAQNNAEALVNAALARLRTGGYTYTLEPGVYGQH
TADEFWFDRKEGFCEHIASSFVVLMRALDIPARIVTGYQGGDRNPVDGLWTLRQADAHAW
AEVWLAGRGWVRVDPTGAVAPGRTGAFERLRAPQGALAAAMGTVLSPGLAQSLRAVWEAV
NNSWNQWVLDYTQSRQLDLLKALGFEAPSWQDLTMVLGFLIIFAALAGMAWSLWERSQHD
PWLRLLARARQRLARAGLVLPPTLPPRAMAERVQAQFGAPAAAVADWLLRLERLRYAPQP
DTEWSHLRREFNTLPWPPASKH