Protein Info for Ac3H11_3191 in Acidovorax sp. GW101-3H11

Annotation: Potassium efflux system KefA protein / Small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 50 to 73 (24 residues), see Phobius details amino acids 79 to 103 (25 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 229 to 259 (31 residues), see Phobius details PF21088: MS_channel_1st" amino acids 206 to 246 (41 residues), 30.2 bits, see alignment 5.2e-11 PF00924: MS_channel_2nd" amino acids 248 to 313 (66 residues), 69.8 bits, see alignment E=2.6e-23 PF21082: MS_channel_3rd" amino acids 323 to 405 (83 residues), 49.2 bits, see alignment E=8.6e-17

Best Hits

KEGG orthology group: None (inferred from 72% identity to rfr:Rfer_2527)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165IUQ1 at UniProt or InterPro

Protein Sequence (438 amino acids)

>Ac3H11_3191 Potassium efflux system KefA protein / Small-conductance mechanosensitive channel (Acidovorax sp. GW101-3H11)
MLDDVGLWVQAFLSPTVLVELAALAGCVALAWALVALLQRGLQRGDPRSILFGVRIVDGA
LFPLLLLGLAYVARTVLHHWVALAAFKVAIPVLVALVVIRIGVKVLQVAYPDAAWVRPIE
RSISWLAWLGMVLWVTGLLPLVLDELDQIHWKVGGATLSVRTMIEGAVTAGAVLLIALWV
SAAIESRLLRSATGAELSLRKAVSNAVRALLVFVGLMMALSAVGIDLTALSVLGGAVGVG
IGFGLQKLASNYVSGFVILAERSMRIGDNVRVDNFEGRITAINARYTVVRSSTGRESIVP
NEMLITQRVENLSLADPRVWLSTVVSVAYESDVELVTRLLGEAALASSRVLRDPAPSVAL
SAFGADGLEFTVGFWIADPENGALGLRSEINRAILSALRAHQIEIPYPQRVMHVQVDGGL
AAAMSPGAPAAPAPAPAQ