Protein Info for Ac3H11_3184 in Acidovorax sp. GW101-3H11

Annotation: Acyltransferase 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 206 to 226 (21 residues), see Phobius details amino acids 233 to 249 (17 residues), see Phobius details amino acids 255 to 271 (17 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details amino acids 319 to 339 (21 residues), see Phobius details amino acids 351 to 368 (18 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 11 to 333 (323 residues), 84 bits, see alignment E=5.5e-28

Best Hits

KEGG orthology group: None (inferred from 58% identity to adn:Alide_2357)

Predicted SEED Role

"Acyltransferase 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165IUJ9 at UniProt or InterPro

Protein Sequence (372 amino acids)

>Ac3H11_3184 Acyltransferase 3 (Acidovorax sp. GW101-3H11)
MSSSPSRTPLIDMVKAMACITIVWHHLAFYGPMSDIAQPLAPALMAWLYDYGRMAVQVFL
VLGGYLAAASLAPQGEARFDHAGNAVAKRFVRLVVPYAVALLLTVVVAALVRPWMAHPSV
PEEPTLAQLLANALLLQDIVDEDALSAGVWYVAIDFQLFALSVAVWAGVRALPGAWAQRH
GAVLARAIIVVGVAASLWVFNRMAGLDMWAIYFFGAYGLGMLAFWAVRAPSPAGWLSAIV
LLGGGALAMDFRGRILVALVTALCLVVALRSERVRAWGGFAPLVRVGQMSYSIFLVHFAV
CLLVNAVVSHLWPTSPVPNALGMLLAFVLSLAAGRLLYLRVEQHVPTWSTALRWQAGLVG
TGLLVAVSNNGF