Protein Info for Ac3H11_3170 in Acidovorax sp. GW101-3H11

Annotation: membrane protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 545 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 35 to 58 (24 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details PF08019: EptA_B_N" amino acids 48 to 193 (146 residues), 155.8 bits, see alignment E=8.3e-50 PF00884: Sulfatase" amino acids 223 to 519 (297 residues), 193.7 bits, see alignment E=4.7e-61

Best Hits

KEGG orthology group: K03760, phosphoethanolamine transferase (inferred from 75% identity to vei:Veis_4349)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165IWL4 at UniProt or InterPro

Protein Sequence (545 amino acids)

>Ac3H11_3170 membrane protein, putative (Acidovorax sp. GW101-3H11)
VWVVVLISTWLATACNVPLWREVSQLPGHGSLRGWGFALAFALIVAAGNAALLSLLAWRW
TLKPAVLVLVLMAAFGAYFMLAYGIAIDASMLVNVMQTDVKEAGDLLNLRMLGTVLILAG
PPLLWLYRRPVQRLTALRHVAHNGLLLVGSIAVIVVCLLLVFQDFASTMRNHIKLRYLIN
PLNSVYALGNIAAKPLRMDTSKILPLGRDAQLGASYEGQAKPPLLVLVLGETGRSGNFGL
NGYERDTTPRLSARKDLVSARNAWSCGTSTAASVPCMYSHLGRTGYEGRSANYESLIDVL
HHAGLAVLWVDNQAGCKGVCDRVGETITSTQKDPALCAGGECLDRVMLKELDAQIAALPV
EQRQRGTVVVMHQMGSHGPAYYKRSAPENKKFGPECTSTALQECQREQVTNAYDNSIVET
DHFLDSVLQWLGAQEQQSQTAMIYVADHGESLGENNIYLHGLPYSIAPDVQKHVPWITWL
SPAMQARTHIATGCLQHELAERRITHDHYFHSVLGLMDVKTGAYSAGLDMFGGCKQGAGA
GMSVG