Protein Info for Ac3H11_3115 in Acidovorax sp. GW101-3H11

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 144 to 161 (18 residues), see Phobius details amino acids 167 to 190 (24 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 284 to 301 (18 residues), see Phobius details PF00892: EamA" amino acids 29 to 161 (133 residues), 44.5 bits, see alignment E=8.7e-16 amino acids 171 to 296 (126 residues), 38.9 bits, see alignment E=4.6e-14

Best Hits

KEGG orthology group: None (inferred from 86% identity to vei:Veis_0158)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165IT70 at UniProt or InterPro

Protein Sequence (312 amino acids)

>Ac3H11_3115 putative membrane protein (Acidovorax sp. GW101-3H11)
MSDMRPTQSSTSASTSATLQPLAASGNLRGIVAMVAAVGFFSLMDALLKTLTAHYPAMQV
AALRGWAALPLVALYVLWRGEVPRLLKVRWPLHLLRGGLNVAMLALFAFAIRELALAEAY
TLFFIAPLLITALSTVVLREKVRAAHWVAIALGMVGVLVALRPSQEAFFTLGALAVLAAA
GCYAVSAITGRLLTRTDSSASLVFWTTTLLALGAGTLAWPQWVGVAQAHWPLVAGLAVTG
FAGQLAITEAFRHGQASVVAPFEYTALAWGMGLDWVLWQTVPGYSTLLGGAIIIGSGLYL
VRQERTQAVVPP