Protein Info for Ac3H11_306 in Acidovorax sp. GW101-3H11

Annotation: Epoxyqueuosine (oQ) reductase QueG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 TIGR00276: epoxyqueuosine reductase" amino acids 2 to 347 (346 residues), 452.5 bits, see alignment E=4.1e-140 PF08331: QueG_DUF1730" amino acids 49 to 137 (89 residues), 74.6 bits, see alignment E=4.8e-25 PF13484: Fer4_16" amino acids 189 to 253 (65 residues), 80.5 bits, see alignment E=1.4e-26

Best Hits

Swiss-Prot: 83% identical to QUEG_ALIDK: Epoxyqueuosine reductase (queG) from Alicycliphilus denitrificans (strain DSM 14773 / CIP 107495 / K601)

KEGG orthology group: None (inferred from 87% identity to vei:Veis_1713)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JN87 at UniProt or InterPro

Protein Sequence (348 amino acids)

>Ac3H11_306 Epoxyqueuosine (oQ) reductase QueG (Acidovorax sp. GW101-3H11)
MQEWARELGFSQIGVAGVDLSAAEPGLSAWLAQGFHGEMHYMASHGMKRARPAELVPGTV
SVITARMDYLPRDTGNGAAQGWQAHELSRLTRPQEGIVSVYARGRDYHKVLRARLQKLSD
RIAEAIGPFGHRVFTDSAPVLEAELAARSGQGWRGRHTLVLNREAGSMFFLGEIYVDMAL
PESAPVTAHCGSCSACIDICPTQAIIAPHRIDARRCISYLTIEHAGPIPLELRPLLGNRI
YGCDDCQLICPWNKFAQVSRLPDFDERKGLAGQQLVHLFAWDEPTFLRMTEGGPIRRIGH
ERWLRNVAVALGNALRATGDGAVRAALQARAEDPSALVREHVAWALEI