Protein Info for Ac3H11_3054 in Acidovorax sp. GW101-3H11

Annotation: probable iron binding protein from the HesB_IscA_SufA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 PF01521: Fe-S_biosyn" amino acids 16 to 116 (101 residues), 71.3 bits, see alignment E=4e-24 TIGR00049: iron-sulfur cluster assembly accessory protein" amino acids 17 to 120 (104 residues), 129.1 bits, see alignment E=3.6e-42

Best Hits

Swiss-Prot: 98% identical to ERPA_ACIAC: Putative iron-sulfur cluster insertion protein ErpA (erpA) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: None (inferred from 90% identity to lch:Lcho_3448)

Predicted SEED Role

"probable iron binding protein from the HesB_IscA_SufA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JQI4 at UniProt or InterPro

Protein Sequence (121 amino acids)

>Ac3H11_3054 probable iron binding protein from the HesB_IscA_SufA family (Acidovorax sp. GW101-3H11)
MSAVADNIQTEMPAPILFTDSAAAKVADLIAEEGNPDLKLRVFVQGGGCSGFQYGFTFDE
ITNEDDTTMTKNGVSLLIDAMSYQYLVGAEIDYKEDLQGAQFVIKNPNATTTCGCGSSFS
A