Protein Info for Ac3H11_298 in Acidovorax sp. GW101-3H11

Annotation: EAL domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 PF00563: EAL" amino acids 96 to 211 (116 residues), 38.7 bits, see alignment E=7.8e-14 PF08668: HDOD" amino acids 234 to 339 (106 residues), 50 bits, see alignment E=2.6e-17

Best Hits

KEGG orthology group: K07181, putative signal transduction protein containing EAL and modified HD-GYP domains (inferred from 82% identity to aaa:Acav_1335)

Predicted SEED Role

"EAL domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JN01 at UniProt or InterPro

Protein Sequence (422 amino acids)

>Ac3H11_298 EAL domain protein (Acidovorax sp. GW101-3H11)
MTSPTTPGLSLTPPPPGNQSSVAMIARQAIVNAQQVVVGYELFNRSRSGAAHTAATDVIL
VFTALSHAGTEELVGKKLIFVNCTHESLSGGHLELVDPDKVVLEIPPLGHAAAEEVATRM
PILAELRNRGFHLAFNHTVLQSAYAPWLPLADYIKLDLSVLAPDQLAVLISYAGRNSQAE
LIAEKVETAQQYDMVSSQGVQMFQGYWFARPSLVEAKLLAPSQASIIELINQVRKQASTD
DIEETLKKDAGLAFNLMRLINSAGFGLSREITSFRQAVMLMGLKKLFRWAALLLTASRAG
GTPSSVGQTAVVRGRLMELLALETLPAEEADQAFVVGIFSLLDVMLSMPMESALGLLNVP
EPVAAALLRREGFLGDLLTLAEACESSDDAVFDRTAGLLHLTSQQINFAHLQALAWADHL
GD