Protein Info for Ac3H11_2881 in Acidovorax sp. GW101-3H11

Annotation: Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 PF00005: ABC_tran" amino acids 20 to 170 (151 residues), 103.4 bits, see alignment E=1.7e-33 amino acids 272 to 424 (153 residues), 71.4 bits, see alignment E=1.2e-23 PF13304: AAA_21" amino acids 371 to 452 (82 residues), 32.2 bits, see alignment E=1.2e-11

Best Hits

KEGG orthology group: K10441, ribose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 84% identity to vei:Veis_3274)

MetaCyc: 43% identical to ribose ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-28-RXN

Predicted SEED Role

"Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165L249 at UniProt or InterPro

Protein Sequence (496 amino acids)

>Ac3H11_2881 Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1) (Acidovorax sp. GW101-3H11)
MSVAVEFRNVTKEFGPVRVLHGVGFALQPGRVYGLLGENGAGKSTLMKILAGYESPTTGE
VVVDGAVRAPGGGSRAAEAQGIVLIHQEFNLADDLTIAQNIFLGHEIKRGLFLDDKAMRE
KTREALAKVGLPLDPDTRVRKLIVAEKQLVEIARALARNARLLIMDEPTATLTPGETERL
FALMAGLKAAGVTIIYISHKLDEVERTTDEVVVMRDGLLVAREATASVTRRQMANLMVGR
ELADLFPPKLPAPQDGAPAITVRGLTVPGWAEGVDFEVRRGEILGFAGLVGAGRTELFEG
LLGLRPRTAGTVEIAGQPVQLKSPRDAARHGLTYLSEDRKGKGLHVHFGLRPNLTLMALE
RYAKPWLDPAAEQAALREAVQEFGIRTGSLEVRASSLSGGNQQKLALAKVLHPGPSVVVL
DEPTRGVDVGAKREIYHLVQRLAEQGLAVIVISSELMELIGLCHRVAVMRAGRLQTTLQE
PHLTEEELIAHATGTR