Protein Info for Ac3H11_2854 in Acidovorax sp. GW101-3H11

Annotation: GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain" amino acids 6 to 203 (198 residues), 223.6 bits, see alignment E=1.4e-70 PF00117: GATase" amino acids 7 to 198 (192 residues), 129.5 bits, see alignment E=3.2e-41 PF07722: Peptidase_C26" amino acids 73 to 182 (110 residues), 34.6 bits, see alignment E=4.4e-12 TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain" amino acids 212 to 538 (327 residues), 469 bits, see alignment E=7.2e-145 PF02540: NAD_synthase" amino acids 213 to 253 (41 residues), 29 bits, see alignment 1.5e-10 PF00958: GMP_synt_C" amino acids 451 to 537 (87 residues), 141 bits, see alignment E=2.5e-45

Best Hits

Swiss-Prot: 85% identical to GUAA_METPP: GMP synthase [glutamine-hydrolyzing] (guaA) from Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 93% identity to dac:Daci_3013)

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165L1N3 at UniProt or InterPro

Protein Sequence (538 amino acids)

>Ac3H11_2854 GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2) (Acidovorax sp. GW101-3H11)
MQHQKILILDFGSQVTQLIARRVREAHVYCEVHPCDVTDEWIRDYAKDGSLKGVILSGSH
ASVYEVDDKAPDAVFELGIPVLGICYGMQTMAQQLGGKVEGSNTREFGYAEVRAHGHTEL
LKGIEDFATPEGHGMLKVWMSHGDKVTALPPGFKVMCSTPSCPIAGMADESRHYYAVQFH
PEVTHTLQGRALLERFVLGICGTRADWVMGDYIEEAVQKIREQVGDEEVILGLSGGVDSS
VAAALIHRAIGDQLTCVFVDHGLLRLNEGDMVMDMFEGKLHAKVIRVDASDLFLGKLAGV
SEPEQKRKIIGGLFVDVFKAEAAKLKAGTGGHKGATFLAQGTIYPDVIESGGAKSKKAVT
IKSHHNVGGLPEQLGLKLLEPLRDLFKDEVRELGVALGLPPEMVYRHPFPGPGLGVRILG
EVKKEYADLLRRADAIFIEELRNFKDDATGKTWYDLTSQAFTVFLPVKSVGVMGDGRTYD
YVVALRAVQTSDFMTADWAELPYALLKKVSGRIINEVRGINRVTYDVSSKPPATIEWE