Protein Info for Ac3H11_2824 in Acidovorax sp. GW101-3H11

Annotation: Integration host factor alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 117 PF18291: HU-HIG" amino acids 14 to 114 (101 residues), 30 bits, see alignment E=4.8e-11 TIGR00987: integration host factor, alpha subunit" amino acids 22 to 116 (95 residues), 121.1 bits, see alignment E=1e-39 PF00216: Bac_DNA_binding" amino acids 23 to 111 (89 residues), 102.1 bits, see alignment E=1.6e-33

Best Hits

Swiss-Prot: 85% identical to IHFA_POLSJ: Integration host factor subunit alpha (ihfA) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K04764, integration host factor subunit alpha (inferred from 93% identity to vei:Veis_3095)

Predicted SEED Role

"Integration host factor alpha subunit" in subsystem DNA structural proteins, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165L158 at UniProt or InterPro

Protein Sequence (117 amino acids)

>Ac3H11_2824 Integration host factor alpha subunit (Acidovorax sp. GW101-3H11)
LMMLNGSDAVIEFAVESLETPALTKAQLADLLFDQIGLNKRESKDMIDAFFDLIAQSLVE
GKDVKLSGFGNFQIRTKAPRPGRNPRTGEAIPIKARRVVTFHASSKLKEQIQTAAAV