Protein Info for Ac3H11_2824 in Acidovorax sp. GW101-3H11
Annotation: Integration host factor alpha subunit
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 85% identical to IHFA_POLSJ: Integration host factor subunit alpha (ihfA) from Polaromonas sp. (strain JS666 / ATCC BAA-500)
KEGG orthology group: K04764, integration host factor subunit alpha (inferred from 93% identity to vei:Veis_3095)Predicted SEED Role
"Integration host factor alpha subunit" in subsystem DNA structural proteins, bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A165L158 at UniProt or InterPro
Protein Sequence (117 amino acids)
>Ac3H11_2824 Integration host factor alpha subunit (Acidovorax sp. GW101-3H11) LMMLNGSDAVIEFAVESLETPALTKAQLADLLFDQIGLNKRESKDMIDAFFDLIAQSLVE GKDVKLSGFGNFQIRTKAPRPGRNPRTGEAIPIKARRVVTFHASSKLKEQIQTAAAV