Protein Info for Ac3H11_2786 in Acidovorax sp. GW101-3H11

Annotation: Pantoate--beta-alanine ligase (EC 6.3.2.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 TIGR00018: pantoate--beta-alanine ligase" amino acids 1 to 278 (278 residues), 245 bits, see alignment E=3.9e-77 PF02569: Pantoate_ligase" amino acids 2 to 278 (277 residues), 294.7 bits, see alignment E=2.8e-92

Best Hits

Swiss-Prot: 74% identical to PANC_ACIAC: Pantothenate synthetase (panC) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K01918, pantoate--beta-alanine ligase [EC: 6.3.2.1] (inferred from 74% identity to aaa:Acav_3761)

Predicted SEED Role

"Pantoate--beta-alanine ligase (EC 6.3.2.1)" in subsystem Coenzyme A Biosynthesis (EC 6.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.1

Use Curated BLAST to search for 6.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165L089 at UniProt or InterPro

Protein Sequence (280 amino acids)

>Ac3H11_2786 Pantoate--beta-alanine ligase (EC 6.3.2.1) (Acidovorax sp. GW101-3H11)
MQIVHTISDLRDALAGRGRPAFVPTMGNLHDGHLALVRQAKPLGSVMVVSIFVNRLQFLP
HEDFDSYPRTLEIDAGKLHAEGCDVLFAPAEKDLYPQPQTFKVQPDPRLADILEGHFRPG
FFTGVCTVVMKLLACVFSGGPGTAVFGRKDYQQVLVIRRMVEQFALPIDIVTGDTCRAGD
GLALSSRNGYLDEAERAQAVQLSQALRALADAALQLGASLPALEAQAVERLRKQGWQPDY
LTVRQRADLLPPAEAPQPGQLVVLGAARLGGTRLIDNLEF