Protein Info for Ac3H11_273 in Acidovorax sp. GW101-3H11

Annotation: Topoisomerase IV subunit B (EC 5.99.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 678 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF02518: HATPase_c" amino acids 59 to 200 (142 residues), 51 bits, see alignment E=3.7e-17 PF00204: DNA_gyraseB" amino acids 248 to 420 (173 residues), 120.4 bits, see alignment E=1.2e-38 PF01751: Toprim" amino acids 448 to 562 (115 residues), 45.9 bits, see alignment E=1.1e-15 PF00986: DNA_gyraseB_C" amino acids 603 to 668 (66 residues), 79.6 bits, see alignment E=3.2e-26

Best Hits

KEGG orthology group: K02622, topoisomerase IV subunit B [EC: 5.99.1.-] (inferred from 92% identity to ajs:Ajs_1014)

Predicted SEED Role

"Topoisomerase IV subunit B (EC 5.99.1.-)" in subsystem DNA topoisomerases, Type II, ATP-dependent or Resistance to fluoroquinolones (EC 5.99.1.-)

Isozymes

Compare fitness of predicted isozymes for: 5.99.1.-

Use Curated BLAST to search for 5.99.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JME9 at UniProt or InterPro

Protein Sequence (678 amino acids)

>Ac3H11_273 Topoisomerase IV subunit B (EC 5.99.1.-) (Acidovorax sp. GW101-3H11)
MTGFLSSYAAPAALQFAAMSAKPSSASASEYSEGSIRVLKGLEPVKQRPGMYTRTDNPLH
IIQEVLDNAADEALAGYGKKIRVTLHADGSVSVEDDGRGIPFGMHPEENAPVIELVFTRL
HAGGKFDKGKGGAYSFSGGLHGVGVSVTNALATRLEATSYREGKVARLVFSAGDVIEPLV
ARPLEAGERKQGTSVRVWPDAKYFESSALPMGELTHLLRSKAVLMPGVTVQLVNEKTRDT
QTWQYKGGLRDYLMQTLNGDPVIPLFEGEGFADRNNESFAEGEGAAWAVAFTEDGQPVRE
SYVNLIPTSAGGTHESGLRDGLFNAVKSFIELHSLLPKGVKLLPEDVFARASYVLSAKVL
DPQFQGQIKERLNSRDAVRLVSGFVRPALELWLNQHVEYGKKLAELAIKAAQTRQKAGQK
VEKRKGSGVAVLPGKLTDCESKDIAHNEVFLVEGDSAGGSAKMGRDKESQAILPLRGKVL
NTWEVERDRLFANNEIHDISVAIGVDPHGPNDTPDLSGLRYGKVCILSDADVDGSHIQVL
LLTLFFRHFPKLIETGHIYVARPPLFRVDVPARGKKPAAKMYALDDGELTAILDKCAKDG
VPKEKCQISRFKGLGEMNAEQLWETTLNPDTRRLLPVQLGDMDFAATEGLITKLMGKGEA
AARRELMELHGDAVEIDI