Protein Info for Ac3H11_2710 in Acidovorax sp. GW101-3H11

Annotation: short-chain dehydrogenase/reductase SDR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF00106: adh_short" amino acids 11 to 199 (189 residues), 147.3 bits, see alignment E=5.9e-47 PF08659: KR" amino acids 14 to 170 (157 residues), 27.3 bits, see alignment E=4.9e-10 PF13561: adh_short_C2" amino acids 17 to 226 (210 residues), 106.5 bits, see alignment E=2.5e-34

Best Hits

KEGG orthology group: None (inferred from 52% identity to cak:Caul_1924)

MetaCyc: 33% identical to lyngbyatoxin A monooxygenase (Moorena producens)
1.14.13.-; 1.14.13.-

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165L661 at UniProt or InterPro

Protein Sequence (245 amino acids)

>Ac3H11_2710 short-chain dehydrogenase/reductase SDR (Acidovorax sp. GW101-3H11)
VNEAKRHLQGKVAVVTGASSGIGEAIAHELSAAGCSLVLTARRAERLNALCAQLPGPAVP
LSAAIDEPATAQALLELAHRTYGRADILVNNAGMLVTGTLETIDLDGLMQMTRTNYDAVV
RTSYVFARAFKQQGAGAIINVSSVGAYLSHSSMGVYAGLKQAVEVFSTALRVELKGSGVR
VGTIAPGTTETEIFDRLRASGQPVRADQTPALQSSDVASAVRYMLEQPKHVSVARMLMVS
SSESV