Protein Info for Ac3H11_2650 in Acidovorax sp. GW101-3H11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 549 transmembrane" amino acids 79 to 99 (21 residues), see Phobius details amino acids 112 to 138 (27 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details amino acids 252 to 273 (22 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details amino acids 316 to 338 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to adk:Alide2_2760)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KY45 at UniProt or InterPro

Protein Sequence (549 amino acids)

>Ac3H11_2650 hypothetical protein (Acidovorax sp. GW101-3H11)
MTRYTPDSSLNDQSSSVPSTEGTQKPTEEAPLKTPGGSSSQEGRQYQASAQLSGKQLETA
TKPAEVWWLARLKEHPFKAFSLAVSVYGGLILLAFFTHLGSMPDLDLAGATATVAAVAVI
GLLVIFTLGGSTIAAGVVTRSLASYVPHLASLRSLMFLAAPGGIFIAAVVVSVISEKTLS
TTCWIWFTLALSFFVPALGCWYQQQNKSVFEAEPGVESGAQCKSPSEGGAKSILENGNAA
ARRKEPETWEEYVAYLASGFIWLVSAMMAFVTYEALTRQSNVDSLKFAAGLGGWGVISIL
LNMVVVRIPQKAQIPAFIASGAAAVLILTMLTSAWMAIPVAVVRTLGLGEIPVGVVLTPE
GCETFNKSARGQQICQLDADKKLGWACPVILKSRIGAPMVFELASFGDDGRWPIWPAEIE
KGRLGGSVGHLRYQRIQVAKSEVRSWPSVTPFVPSEPKESGQQPAQDAGPAEGGGTRGEA
GGDVVSKQANLSPLVSYLNLKDAGLSDAQRQWLARQCGPALNSEAATPPKAIPNRTAPIA
RKANTGKEP