Protein Info for Ac3H11_2582 in Acidovorax sp. GW101-3H11

Annotation: Na(+) H(+) antiporter subunit A; Na(+) H(+) antiporter subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 988 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 77 to 97 (21 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 132 to 150 (19 residues), see Phobius details amino acids 162 to 185 (24 residues), see Phobius details amino acids 205 to 229 (25 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details amino acids 270 to 291 (22 residues), see Phobius details amino acids 298 to 316 (19 residues), see Phobius details amino acids 322 to 346 (25 residues), see Phobius details amino acids 367 to 389 (23 residues), see Phobius details amino acids 409 to 427 (19 residues), see Phobius details amino acids 459 to 481 (23 residues), see Phobius details amino acids 501 to 523 (23 residues), see Phobius details amino acids 572 to 591 (20 residues), see Phobius details amino acids 603 to 624 (22 residues), see Phobius details amino acids 631 to 651 (21 residues), see Phobius details amino acids 657 to 678 (22 residues), see Phobius details amino acids 704 to 723 (20 residues), see Phobius details amino acids 760 to 778 (19 residues), see Phobius details amino acids 817 to 841 (25 residues), see Phobius details amino acids 852 to 873 (22 residues), see Phobius details amino acids 885 to 905 (21 residues), see Phobius details amino acids 925 to 950 (26 residues), see Phobius details PF00662: Proton_antipo_N" amino acids 66 to 110 (45 residues), 34.2 bits, see alignment 4.7e-12 PF00361: Proton_antipo_M" amino acids 126 to 403 (278 residues), 210.9 bits, see alignment E=6e-66 PF13244: MbhD" amino acids 616 to 680 (65 residues), 70.8 bits, see alignment 2.1e-23 PF20501: MbhE" amino acids 698 to 795 (98 residues), 149.1 bits, see alignment E=8.2e-48 PF04039: MnhB" amino acids 822 to 944 (123 residues), 123.8 bits, see alignment E=1.3e-39

Best Hits

KEGG orthology group: K05559, multicomponent K+:H+ antiporter subunit A (inferred from 80% identity to ajs:Ajs_2474)

Predicted SEED Role

"Na(+) H(+) antiporter subunit A; Na(+) H(+) antiporter subunit B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KX14 at UniProt or InterPro

Protein Sequence (988 amino acids)

>Ac3H11_2582 Na(+) H(+) antiporter subunit A; Na(+) H(+) antiporter subunit B (Acidovorax sp. GW101-3H11)
MPLITLILLPFIGSLLAAVLPANARNTESTLAGLIALFCTVQAALYFPEIADGGVIRQEL
AWLPALGLNLVIRMDGFAWMFCMLVLGVGSLVVLYARYYMSPADPVPRFFSFFLAFMGAM
AGVVLSGNIVQIAFFWELTSLFSFLLIGYWHHRKDARRGARMALTVTGTGGLAMLAGMLV
LGHIVGSYDLDHVLVAGQLIQNHPLYLAALVLILLGALTKSAQFPFHFWLPNAMAAPTPV
SAYLHSATMVKAGVFLMARLWPALSGTEEWFWLVGGAGLATLLVGGYAAMFQNDLKGLLA
YSTISHLGLITLLLGLNSPLAAVAAVFHIMNHATFKASLFMAVGIVDHESGTRDIRRLSG
LRTMMPITATLAMVASAAMAGVPLLNGFLSKEMFFAETVYVNTAPLLEWLLPVAATVAGM
FSVAYSLRFTVDVFFGPPATDLPRPPHEPPHWMRVPVELLVLACLVVGTLPAWSVGAYLA
AAARPVVGGELPTYSLAVWHGINTPFVMSLVALGGGIALYALLRRQRARGTLDAPPLMHR
LSGQRMFEHLLAALTLAGRNGRRLLGTGRLQWQMLWLATAALVAGTLPLWVRGLPIGDRA
QLPLSPTFALLWLLGAVCAVAAAWQAKYHRLAALTLLGGAGLCVCLTFLWFSAPDLALTQ
IVVEIVTTILILLGLRWLPRRDESLRVPTLAEERRTQLRRWRDLALALSAGAGMALLSFA
MMSRPFPDSTSTFFLERALTEGGGTNVVNVMLVDFRGFDTFGEIVVLGIVALTVYALLRR
FRPAREVMDLPPQQRALPADVDTDLANPRQTADTAVGYLMVPAVLVRLLLPFATLVSMYL
FMRGHNEPGGGFVAGLVFSVALLLQYIVSGTSWVEAHLPLYPRRWIGIGLLAALATGLGA
WAWGYPFLTSHTAHFALPVVGEIHVASALFFDIGVFTLVVGSTMLILTGIAHQSVRSHRY
NNARADDEAAEQAAAATVPTTRGETAWN