Protein Info for Ac3H11_2515 in Acidovorax sp. GW101-3H11

Annotation: ElaA protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF00583: Acetyltransf_1" amino acids 34 to 128 (95 residues), 26.6 bits, see alignment E=9.3e-10 PF13673: Acetyltransf_10" amino acids 41 to 146 (106 residues), 51.8 bits, see alignment E=1.2e-17 PF13508: Acetyltransf_7" amino acids 47 to 129 (83 residues), 28.9 bits, see alignment E=1.8e-10

Best Hits

Swiss-Prot: 44% identical to Y451_SYNY3: UPF0039 protein sll0451 (sll0451) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02348, ElaA protein (inferred from 74% identity to aaa:Acav_2369)

Predicted SEED Role

"ElaA protein" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KVM5 at UniProt or InterPro

Protein Sequence (154 amino acids)

>Ac3H11_2515 ElaA protein (Acidovorax sp. GW101-3H11)
MALRWLWACFDDLGVHALHDALALRCKVFILEQGPYQDPDRADKQSHHLLGYDEAGVLQA
CLRVADPGVNYPEPSIGRVVTAKEARGNGTGRALMAEGIARCSQAWPGRGIRISAQAHLQ
GFYGSLGFEAVSDEYLEDDIPHVEMLRRGDHPAA