Protein Info for Ac3H11_2501 in Acidovorax sp. GW101-3H11

Annotation: Transcription accessory protein (S1 RNA-binding domain)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 789 PF09371: Tex_N" amino acids 8 to 200 (193 residues), 219.1 bits, see alignment E=1.2e-68 PF16921: Tex_YqgF" amino acids 336 to 464 (129 residues), 176 bits, see alignment E=1.3e-55 PF14635: HHH_7" amino acids 477 to 569 (93 residues), 30.2 bits, see alignment E=1.5e-10 PF12836: HHH_3" amino acids 504 to 568 (65 residues), 92.7 bits, see alignment E=3.9e-30 PF17674: HHH_9" amino acids 574 to 643 (70 residues), 83.5 bits, see alignment E=4.6e-27 PF00575: S1" amino acids 661 to 733 (73 residues), 72.2 bits, see alignment E=1.1e-23

Best Hits

KEGG orthology group: K06959, uncharacterized protein (inferred from 88% identity to aav:Aave_3421)

Predicted SEED Role

"Transcription accessory protein (S1 RNA-binding domain)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KVE7 at UniProt or InterPro

Protein Sequence (789 amino acids)

>Ac3H11_2501 Transcription accessory protein (S1 RNA-binding domain) (Acidovorax sp. GW101-3H11)
MQQIVRQLAAEIKVSESQVRAAVELLDGGATVPFIARYRKEVTGGLDDIQLRELEARLSY
LRELEDRRVAVLKAIDEQGKLTDALRAAIATAPTKQELEDIYLPFKQKRRTKGQIAREFG
IEPLADKLFADPTLDPAVEAAAFTKPPEVLDDGKPGADFSTVPAVLDGVRDILSERWAED
PALVQNLREWLWAEGLLRSKKVESKNENDPEVSKFRDYFEYDEPIGRVPSHRALAVFRGR
GLEILEAKLVLPVEPEPGKPSLAEGKIALHLGWSHAGRKADDLIRKCVAWTWRVKLSLST
ERDLFARLRDDAEKVAIKVFADNLRDLLLAAPAGPRVVMGLDPGIRTGVKVAVVDATGKL
VETATVYPHEPKRDWDGSLFTLAKLVEKHGVNLIAIGNGTASRETDKLAADLIKMAAKAE
RAIEKVVVSEAGASVYSASEYASQEMPDVDVSLRGAASIARRLQDPLAELVKIDPKSIGV
GQYQHDVNQSELARTLGTVVEDCVNSVGVDLNTASVPLLSRVSGLSGSVAKAVVRWREAN
GAFKSRKQLMDVAGLGAKTFEQSAGFLRIRGGENPLDMTGVHPETYPVVEQIMEKTGKPV
AEIMGRADMLKTLKPELFANDKFGVITVKDILTELEKPGRDPRPDFKVARFNDGVEDIKD
LKEGMVLEGTVSNVAQFGAFIDLGVHQDGLVHVSQLAHKFVNDAREVVKTGDIVKVKVME
VDVERKRIGLSMKLDAAPRPQGDRDRGPRDNRFEGAGRGYAQPPRRANEAAQPSAMASAF
AKLQQAKGR