Protein Info for Ac3H11_2468 in Acidovorax sp. GW101-3H11

Annotation: membrane protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 signal peptide" amino acids 1 to 12 (12 residues), see Phobius details transmembrane" amino acids 13 to 26 (14 residues), see Phobius details amino acids 33 to 50 (18 residues), see Phobius details amino acids 60 to 84 (25 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details amino acids 158 to 176 (19 residues), see Phobius details amino acids 213 to 234 (22 residues), see Phobius details amino acids 239 to 291 (53 residues), see Phobius details amino acids 309 to 338 (30 residues), see Phobius details PF01594: AI-2E_transport" amino acids 14 to 339 (326 residues), 165.6 bits, see alignment E=8.7e-53

Best Hits

KEGG orthology group: None (inferred from 84% identity to vei:Veis_3980)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KUU9 at UniProt or InterPro

Protein Sequence (354 amino acids)

>Ac3H11_2468 membrane protein, putative (Acidovorax sp. GW101-3H11)
MTPNHLQDKAFLLLLIAVTIAFGAILWQFHGAVFWGVILAILFAPLHRKLLKRMPKRPTL
AALCTLGLCLVIVILPMTAITVSLVQEASVIYERVRSGQLNFGLYLQQVIAALPAWAANL
LERLNLTSIGELQQKLSSVAVQASQFVATQALSIGQNTLEFLVGFGIMLYLLFFLLRDGA
SLARRIGHATPLDDAHKRQLVSKFTTVIRATVKGNIVVAASQGALGGLIFWVLGIQGPVL
WGVLMAFLSLLPAVGAGLIWVPVAIYFLATGAVWQGAVLTAFGIGVIGLVDNVLRPILVG
KDTKMPDYIVLISTLGGMGLFGLTGFVIGPVIAALFMASWDLFAPNQTDSTASP